Germany
Japan
United Kingdom
China
Rabbit anti-CLOCK polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Antibodies
View as table Download
Rabbit polyclonal anti-CRY1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CRY1. |
Rabbit polyclonal anti-PER3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PER3. |
Rabbit Polyclonal Anti-PER1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PER1 antibody is: synthetic peptide directed towards the N-terminal region of Human PER1. Synthetic peptide located within the following region: LADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTESS |
Rabbit Polyclonal Anti-BHLHB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI |
Rabbit Polyclonal Anti-NR1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the N terminal of human NR1D1. Synthetic peptide located within the following region: NGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSS |
Rabbit Polyclonal Anti-PER3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PER3 Antibody: synthetic peptide directed towards the N terminal of human PER3. Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL |
Rabbit Polyclonal Anti-NPAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the N terminal of human NPAS2. Synthetic peptide located within the following region: MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLE |
Rabbit Polyclonal Anti-NPAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the C terminal of human NPAS2. Synthetic peptide located within the following region: DSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR |
Rabbit Polyclonal Anti-NR1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the middle region of human NR1D1. Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA |
Rabbit Polyclonal Anti-CSNK1E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH |
Rabbit Polyclonal Anti-PER1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PER1 antibody is: synthetic peptide directed towards the N-terminal region of Human PER1. Synthetic peptide located within the following region: SGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNG |
Rabbit Polyclonal Anti-Clock Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock |
Rabbit Polyclonal Anti-BHLHB3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3 |
PER1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human PER1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Clonalities
- Polyclonal
Pathways
- Circadian rhythm - mammal