Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC |
Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Porcine Collagen, types 1 and 3 from skin |
Collagen I (COL1A2) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human COL1A2 |
USD 550.00
5 Days
Collagen I (COL1A1) (+ type II, III, IV, and V) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A mixture of human collagen 1-5 from human placenta. |
Collagen I (COL1A1) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human type 1 Collagen |
Rabbit Polyclonal Collagen I Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Collagen I |
Rabbit anti Collagen I Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein encoding aa 1160-1367 of human collagen I expressed in E.Coli. |
Germany
Japan
United Kingdom
China