Antibodies

View as table Download

Rabbit Polyclonal Anti-Eomes Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Eomes antibody: synthetic peptide directed towards the C terminal of human Eomes. Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY

Rabbit Polyclonal anti-EOMES antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EOMES antibody: synthetic peptide directed towards the N terminal of human EOMES. Synthetic peptide located within the following region: SVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLS

Rabbit Polyclonal Anti-EOMES Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EOMES antibody: synthetic peptide directed towards the middle region of human EOMES. Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT