Rabbit Polyclonal Anti-CRBN Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CRBN antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CRBN. |
Rabbit Polyclonal Anti-CRBN Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CRBN antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CRBN. |
Rabbit Polyclonal Anti-CRBN Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CRBN antibody: synthetic peptide directed towards the N terminal of human CRBN. Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL |
CRBN Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human CRBN (NP_001166953.1). |
Modifications | Unmodified |