Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal TLR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against a peptide corresponding to 15 amino acids near the carboxy terminus of human TLR3. The immunogen is located within amino acids 780 - 830 of TLR3.

Interferon beta (IFNB1) rabbit polyclonal antibody

Applications ELISA, FN, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal TLR2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2.

Rabbit Polyclonal TLR4 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal portion of the human TLR4 protein (between residues 650-710) [UniProt O00206]

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.

TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit Polyclonal anti-TLR2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Rabbit Polyclonal TLR7 Antibody

Applications Dot, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to amino acids 706-749 of human TLR7; GenBank no. gb|AAF78035.1|AF245702_1. It will cross-react with mouse TLR7. In human Ramos cells, additional bands are seen.

TLR3 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal Antibody against CD14 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14.

Rabbit Polyclonal anti-TLR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Developed against a synthetic peptide corresponding to amino acids 420-435 of human TLR4.

Rabbit Polyclonal TLR4 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a sythetic peptide corresponding to amino acids 420-456 of human TLR4.

Rabbit Polyclonal Anti-TLR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR2