Antibodies

View as table Download

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.

Rabbit polyclonal anti-CYB5R1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYB5R1.

Goat Polyclonal Antibody against CHIT1 (aa409-423)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EHGPSPGQDTFCQGK, from the internal region (near C Terminus) of the protein sequence according to NP_003456.1.

CHIT1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CHIT1

UXS 1 (UXS1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 336-366 amino acids from the C-terminal region of human UXS1

Rabbit polyclonal antibody to b5R.1 (cytochrome b5 reductase 1)

Applications WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 275 of b5R.1 (Uniprot ID#Q9UHQ9)

Rabbit polyclonal antibody to Chitotriosidase (chitinase 1 (chitotriosidase))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 216 and 463 of Chitotriosidase (Uniprot ID#Q13231)

Rabbit Polyclonal Anti-UXS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UXS1 antibody: synthetic peptide directed towards the middle region of human UXS1. Synthetic peptide located within the following region: LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

UXS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human UXS1

UXS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UXS1

CHIT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CHIT1