Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Goat Polyclonal Antibody against LAT1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GAPDYENLQELN, from the C Terminus of the protein sequence according to NP_055202.1; NP_001014987.1; NP_001014989.1; NP_001014988.1. |
Rabbit polyclonal anti-IL-13 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant mouse IL-13 |
Rabbit polyclonal LAT (Ab-255) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human LAT around the phosphorylation site of tyrosine 255. |
Goat Polyclonal Anti-PLA2G2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLA2G2A Antibody: Peptide with sequence C-SYKFSNSGSRIT, from the internal region of the protein sequence according to NP_000291.1. |
Rabbit Polyclonal Anti-FCER1G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCER1G antibody: synthetic peptide directed towards the N terminal of human FCER1G. Synthetic peptide located within the following region: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Rabbit anti-FCER1A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FCER1A |
Rabbit anti-LAT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LAT |
Goat Anti-FCER1A (aa177-189) Antibody
| Applications | IHC, PEP-ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGKVWQLDYESEP, from the internal region of the protein sequence according to NP_001992.1. |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Active filters
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Fc epsilon RI signaling pathway