Antibodies

Jump to Filters
View as table Download
ITGB6 Rabbit Polyclonal Antibody
TA321227

USD 380.00

4 Weeks

Anti-ITGB6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 139-434 amino acids of human integrin, beta 6
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Integrin beta 1 (ITGB1) Rabbit Polyclonal Antibody
TA349358

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1
ADCY3 Rabbit Polyclonal Antibody
TA349673

USD 380.00

In Stock

Rabbit Polyclonal Anti-ADCY3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ADCY3
CD41 (ITGA2B) Rabbit Polyclonal Antibody
TA350095

USD 380.00

In Stock

Rabbit Polyclonal Anti-ITGA2B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ITGA2B
CD61 (ITGB3) Rabbit Polyclonal Antibody
TA349357

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITGB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB3
alpha Sarcoglycan (SGCA) Rabbit Polyclonal Antibody
TA314526

USD 380.00

2 Weeks

Rabbit polyclonal anti-SGCA antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SGCA.
ITGA7 Rabbit Polyclonal Antibody
TA323045

USD 380.00

In Stock

Anti-ITGA7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1130-1142 amino acids of Human integrin, alpha 7
ADCY4 Rabbit Polyclonal Antibody
TA324113

USD 380.00

In Stock

Anti-ADCY4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4
ADCY4 Rabbit Polyclonal Antibody
TA324114

USD 380.00

In Stock

Anti-ADCY4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4
ADCY5 Rabbit Polyclonal Antibody
TA324124

USD 380.00

In Stock

Anti-ADCY5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1110-1124 amino acids of human adenylate cyclase 5
ADCY5 Rabbit Polyclonal Antibody
TA324125

USD 380.00

In Stock

Anti-ADCY5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1110-1124 amino acids of human adenylate cyclase 5
Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody
TA306659

USD 570.00

2 Weeks

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.
Integrin beta 5 (ITGB5) Rabbit Polyclonal Antibody
TA349359

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITGB5 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB5
Integrin alpha 6 (ITGA6) Rabbit Polyclonal Antibody
TA350804

USD 380.00

In Stock

Rabbit Polyclonal Anti-ITGA6 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA6