Antibodies

Jump to Filters
View as table Download
ZNF444 Rabbit Polyclonal Antibody
TA345248

USD 485.00

5 Days

Rabbit Polyclonal Anti-ZNF444 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the C terminal of human ZNF444. Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH
ZNF444 Rabbit Polyclonal Antibody
TA339508

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZNF444 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the middle region of human ZNF444. Synthetic peptide located within the following region: SSATRVPQDVTQGPGATGGKEDSGMIPLAGTAPGAEGPAPGDSQAVRPYK