Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to POLR2G (polymerase (RNA) II (DNA directed) polypeptide G)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 122 of RNA polymerase IIG (Uniprot ID#P62487) |
Rabbit Polyclonal DNMT1 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT1 antibody: mouse DNMT1 (DNA (cytosine-5)-methyltransferase 1), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Anti-POLR1E Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR1E antibody: synthetic peptide directed towards the N terminal of human POLR1E. Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL |
Rabbit polyclonal anti-NM23 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human NM23. |
Rabbit polyclonal anti-RPC4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC4. |
Rabbit polyclonal anti-POLR3H (RPC8) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC8. |
Anti-DNMT1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1 |
Rabbit Polyclonal NF-kappaB p105/p50 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF-kappaB p105/p50 |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser337) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 337 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser927) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 927 |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Metabolic pathways