Galanin (GAL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 55-86 amino acids from the Central region of human GAL |
Galanin (GAL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 55-86 amino acids from the Central region of human GAL |
Goat Anti-GAL Antibody
Applications | IHC, PEP-ELISA, WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HRSFSDKNGLTSK, from the internal region of the protein sequence according to NP_057057.2. |
Rabbit Polyclonal Anti-GAL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN |