MMP1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Horse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1 |
MMP1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Horse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1 |
Anti-MMP1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase) |
Rabbit Polyclonal Anti-OLR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OLR1 |
Rabbit Polyclonal Anti-APOA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
Anti-APOA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 14-267 amino acids of human apolipoprotein A-I |
Anti-APOA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 14-267 amino acids of human apolipoprotein A-I |
Rabbit Polyclonal Anti-OLR1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human OLR1 |
Anti-MMP1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase) |
Rabbit Polyclonal Antibody against PLTP
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A partial peptide of human PLTP. |
Angiopoietin like 4 (ANGPTL4) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 145~175 amino acids from the Center region of human ANGPTL4 |
Chicken Polyclonal ApoA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1. |
Rabbit polyclonal MMP1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Anti-ANGPTL4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit anti-ANGPTL4 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANGPTL4 |
Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1 |