Antibodies

View as table Download

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S).

AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S).

Rabbit Polyclonal antibody to ULK2 (unc-51-like kinase 2 (C. elegans))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 693 and 968 of ULK2 (Uniprot ID#Q8IYT8)

Anti-PRKAA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit

Rabbit Polyclonal Anti-PIK3R4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3R4

AMPK alpha 2 (PRKAA2) (Center)/(Thr172) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 145-173 amino acids from the Central region of human PRKAA2 (Thr172)

Rabbit Polyclonal ULK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 .

ULK1 rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from Human Unc-51-like kinase 1 (ULK1)

Rabbit Polyclonal ULK3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ULK3 antibody was raised against a 19 amino acid peptide near the center of human ULK3.

AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 450-500 of Human AMPKα1.

Rabbit polyclonal APG1 (ULK1) Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1).

Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

Rabbit Polyclonal ULK1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN.

AMPK alpha 1 (PRKAA1) pSer486 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from Human AMPKα1 around the phosphorylation site of Serine 486.