Rabbit polyclonal anti-BLMH antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Predicted: Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This BLMH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 212-242 amino acids from the Central region of human BLMH. |
Rabbit polyclonal Anti-Blmh Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Blmh antibody is: synthetic peptide directed towards the C-terminal region of Mouse Blmh. Synthetic peptide located within the following region: GPITPLQFYKEHVKPLFNMEDKICFVNDPRPQHKYNKLYTVDYLSNMVGG |
Germany
Japan
United Kingdom
China