Antibodies

View as table Download

Rabbit Polyclonal Anti-APEH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human APEH

Rabbit Polyclonal Anti-APEH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-APEH antibody: synthetic peptide directed towards the N terminal of human APEH. Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR

Rabbit anti-APEH Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human APEH