Antibodies

View as table Download

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW

Rabbit Polyclonal Anti-HTR3C Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HTR3C

Rabbit Polyclonal Anti-GABRB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GABRB1

Rabbit Polyclonal Anti-CHRNA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA2

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA1

Rabbit Polyclonal 5-HT3A Antibody

Applications IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563.

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA1

Anti-GLRA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1

Rabbit Polyclonal Anti-HTR3B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR3B

Anti-CHRNA10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 360-373 amino acids of human cholinergic receptor, nicotinic, alpha 10 (neuronal)

Anti-HTR3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
TA323542 is a possible alternative to TA323541.

Anti-CHRNA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 69-83 amino acids of Human cholinergic receptor, nicotinic, alpha 3 (neuronal)

Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha 4 (extracellular

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DLVNMHSRVDQLD, corresponding to amino acid residues 190-202 of human nAChRa4. Extracellular, N-terminus.

Rabbit Polyclonal Anti-GABRR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY