Antibodies

Jump to Filters
View as table Download
LRRC57 Rabbit Polyclonal Antibody
TA350143

USD 380.00

In Stock

Rabbit Polyclonal Anti-LRRC57 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LRRC57
LRRC57 Rabbit Polyclonal Antibody
TA364876

USD 380.00

4 Weeks

LRRC57 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LRRC57
LRRC57 (C-term) Rabbit Polyclonal Antibody
AP52542PU-N

USD 580.00

2 Weeks

LRRC57 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 205-235 amino acids from the C-terminal region of human LRRC57
LRRC57 Rabbit Polyclonal Antibody
TA330936

USD 539.00

5 Days

Rabbit polyclonal Anti-LRRC57 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC57 antibody: synthetic peptide directed towards the N terminal of human LRRC57. Synthetic peptide located within the following region: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI
LRRC57 Rabbit Polyclonal Antibody
TA330937

USD 539.00

5 Days

Rabbit polyclonal Anti-LRRC57 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC57 antibody: synthetic peptide directed towards the middle region of human LRRC57. Synthetic peptide located within the following region: NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL