Antibodies

Jump to Filters
View as table Download
GALNT10 Rabbit Polyclonal Antibody
TA306815

USD 570.00

5 Days

Rabbit Polyclonal GALNT10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GALNT10 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human GALNT10.
GALNT10 Rabbit Polyclonal Antibody
TA306816

USD 570.00

5 Days

Rabbit Polyclonal GALNT10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GALNT10 antibody was raised against a 16 amino acid peptide near the amino terminus of human GALNT10.
GALNT10 Rabbit Polyclonal Antibody
TA346785

USD 539.00

5 Days

Rabbit Polyclonal Anti-GALNT10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT10 antibody: synthetic peptide directed towards the N terminal of human GALNT10. Synthetic peptide located within the following region: VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS
GALNT10 Rabbit Polyclonal Antibody
TA356741

USD 539.00

5 Days

GALNT10 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human GALNT10
GALNT10 Rabbit Polyclonal Antibody
TA376466

USD 365.00

3 Weeks

GALNT10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 444-603 of human GALNT10 (NP_938080.1).
Modifications Unmodified