Antibodies

View as table Download

A4GALT (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 33-62 amino acids from the N-terminal region of human A4GALT

Rabbit anti-HEXA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HEXA

Rabbit Polyclonal Anti-B3GALNT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GALNT1 Antibody: synthetic peptide directed towards the middle region of human B3GALNT1. Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC

Rabbit Polyclonal Anti-NAGA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the N-terminal region of NAGA. Synthetic peptide located within the following region: GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA

Rabbit Polyclonal Anti-NAGA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the middle region of Human NAGA. Synthetic peptide located within the following region: CFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLAD