A4GALT (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 33-62 amino acids from the N-terminal region of human A4GALT |
A4GALT (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 33-62 amino acids from the N-terminal region of human A4GALT |
Rabbit anti-HEXA Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HEXA |
Rabbit Polyclonal Anti-B3GALNT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-B3GALNT1 Antibody: synthetic peptide directed towards the middle region of human B3GALNT1. Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC |
Rabbit Polyclonal Anti-NAGA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the N-terminal region of NAGA. Synthetic peptide located within the following region: GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA |
Rabbit Polyclonal Anti-NAGA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the middle region of Human NAGA. Synthetic peptide located within the following region: CFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLAD |