Antibodies

Jump to Filters
View as table Download
Wnt8b Rabbit Polyclonal Antibody
TA317526

USD 515.00

5 Days

WNT8B / Wnt 8b Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse
Conjugation Unconjugated
Immunogen WNT8B / Wnt 8b antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Opossum, Platypus (94%); Marmoset (88%).
WNT8B Rabbit Polyclonal Antibody
TA334009

USD 539.00

5 Days

Rabbit Polyclonal Anti-Wnt8b Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wnt8b Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: IADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE
WNT8B Rabbit Polyclonal Antibody
TA344460

USD 539.00

5 Days

Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR