Antibodies

Jump to Filters
View as table Download
SLC2A6 Rabbit Polyclonal Antibody
TA333771

USD 485.00

5 Days

Rabbit Polyclonal Anti-SLC2A6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A6 Antibody: synthetic peptide directed towards the C terminal of human SLC2A6. Synthetic peptide located within the following region: AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL
SLC2A6 Rabbit Polyclonal Antibody
TA333770

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-SLC2A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A6 Antibody: synthetic peptide directed towards the N terminal of human SLC2A6. Synthetic peptide located within the following region: VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV