Rabbit polyclonal anti-CXCL1 (KC) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit polyclonal anti-CXCL1 (KC) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit Polyclonal Anti-GRO alpha
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha |
Rabbit polyclonal anti-MCP-1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with mature length recombinant human MCP-1 protein produced in E.coli. |
Rabbit anti-CCL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL5 |
Rabbit anti-CXCL1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CXCL1 |
Goat Anti-IL-1 beta Antibody
Applications | PEP-ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLESVDPKNYPKK, from the internal region of the protein sequence according to NP_000567.1. |
Rabbit Polyclonal Anti-IL18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
Applications | WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
Rabbit Polyclonal Anti-Interleukin 8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8 |
Rabbit polyclonal IL-1 beta antibody
Applications | WB |
Reactivities | Human, Primate, Dog |
Conjugation | Unconjugated |
Immunogen | This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1). |
Rabbit polyclonal anti-IL-6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with recombinant human IL-6 produced in E.coli. |
Rabbit Polyclonal Anti-CCL13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL13 antibody: synthetic peptide directed towards the middle region of human CCL13. Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Rabbit Polyclonal Anti-CCL8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL8 antibody: synthetic peptide directed towards the middle region of human CCL8. Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
Rabbit Polyclonal Anti-CXCL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL1 antibody: synthetic peptide directed towards the middle region of human CXCL1. Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Rabbit Polyclonal TNFA Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |