IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
Anti-ACTN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1 |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-FCGR2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FCGR2B |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
Rabbit Polyclonal Anti-FCGR3A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FCGR3A |
Goat Polyclonal Antibody against CD32 / FCGR2B
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PDALEEPDDQNRI, from the C Terminus of the protein sequence according to NP_003992.3; NP_001002273.1; NP_001002274.1; NP_001002275.1;. |
FCGR2A Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FCGR2A |
FCGR2B Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ACTN1 (aa596-609) Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Internal region (TPQEINGKWDHVRQ) |
Goat Polyclonal Anti-IL10 Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse, Canine, Monkey |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human IL10 produced in E. coli. |
Rabbit Polyclonal Anti-FCGR2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FCGR2C Antibody is: synthetic peptide directed towards the N-terminal region of Human FCGR2C. Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD |
FCGR2B Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ACTN1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1. |