Antibodies

Jump to Filters
View as table Download
ENC1 Chicken Polyclonal Antibody
TA306962

USD 570.00

5 Days

Chicken Polyclonal ENC-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ENC-1 antibody was raised against a 13 amino acid peptide near the center of human ENC-1.
ENC1 Rabbit Polyclonal Antibody
TA335766

USD 539.00

5 Days

Rabbit Polyclonal Anti-ENC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENC1 Antibody: synthetic peptide directed towards the N terminal of human ENC1. Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL