Rabbit polyclonal anti-AOX1 antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AOX1. |
Rabbit polyclonal anti-AOX1 antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AOX1. |
Rabbit anti-ALDH3A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH3A1 |
Rabbit Polyclonal Anti-COMT Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH |
Rabbit polyclonal anti-AOX1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AOX1 |
Monoamine Oxidase A (MAOA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MIF (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human MIF |
Goat Polyclonal Antibody against MAOB
Applications | FC, IF, IHC, PEP-ELISA, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Goat Polyclonal Antibody against MIF
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Rat, Mouse) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NAANVGWNNSTFA, from the C Terminus of the protein sequence according to NP_002406.1. |
Rabbit anti-MAOA Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOA |
Rabbit polyclonal anti-AOX1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AOX1 |
Goat Anti-Tyrosine Hydroxylase Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VQDELDTLAHAL, from the C Terminus of the protein sequence according to NP_954986.2; NP_000351.2; NP_954987.2. |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
Applications | WB |
Reactivities | Bovine, Dog, Human, Rabbit, Rat, Sheep, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bovine, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse, Orang-Utan, Guinea Pig (Predicted: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Rabbit Polyclonal Tyrosine Hydroxylase Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Tyrosine Hydroxylase |
Rabbit Polyclonal Tyrosine Hydroxylase (Ser19) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine 19 |
Modifications | Phospho-specific |