USD 229.00
USD 458.00
In Stock
MAPK1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700062, TA700064 |
USD 229.00
USD 458.00
In Stock
MAPK1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700062, TA700064 |
PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan. |
NRAS mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 925.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TUBB2A Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
USD 494.00
3 Weeks
purified EGFR biotinylated mouse monoclonal detection antibody, validated for Luminex assays
Applications | ELISA |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600469, TA600472 |
Mouse Monoclonal Anti-alpha-Tubulin Antibody [2B11]
Applications | WB |
Reactivities | Human, Mouse, Rat, Rabbit, Zebrafish |
Conjugation | Unconjugated |
USD 875.00
2 Weeks
Dopamine D2 Receptor (DRD2) (long isoform, 243-254) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | D2L (243-254) cyclized covalently attached to a carrier protein. |
Mouse Monoclonal GRB2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |