Antibodies

View as table Download

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications Phospho-specific

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707)

Anti-MYH11 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1958-1972 amino acids of Human myosin, heavy chain 11, smooth muscle

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C).
Modifications Phospho-specific

Mouse anti pTEN Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE