Rabbit Polyclonal antibody to ADCK1 (aarF domain containing kinase 1)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 45 and 213 of ADCK1 |
Rabbit Polyclonal Anti-SHH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Chicken |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Periostin (POSTN) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human OSF-2 Source of Antigen: E. coli. |
Germany
Japan
United Kingdom
China
