Mouse monoclonal anti-GAPDH antibody, clone OTI2D9 (formerly 2D9), loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
Mouse monoclonal anti-GAPDH antibody, clone OTI2D9 (formerly 2D9), loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
Mouse monoclonal anti-GAPDH antibody, clone OTI2D9 (formerly 2D9), loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
GAPDH mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GAPDH mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse monoclonal anti-GAPDH antibody HRP conjugated, clone OTI2D9, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | HRP |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
GAPDH mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila, Primate |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Carrier-free (BSA/glycerol-free) GAPDH mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |