AKT1 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
AKT1 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
AKT3 mouse monoclonal antibody, clone OTI9B2 (formerly 9B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKT1 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
AKT1 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 447.00
In Stock
PIK3CG mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAPK3 (ERK1) mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK3 mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
AKT1 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
MAPK3 (ERK1) mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt |
Modifications | Phospho-specific |
AKT3 mouse monoclonal antibody, clone OTI9B2 (formerly 9B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
Applications | FC |
Reactivities | Feline, Human, Rabbit |
Conjugation | PE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
Applications | FC, FN, IF, IHC, IP, WB |
Reactivities | Feline, Human, Rabbit |
Conjugation | Unconjugated |