Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 2 of 2 results

(reset)

DNMT3A Mouse Monoclonal Antibody [Clone ID: 64B1446]

TA336580

USD 620.00

5 Days

Mouse Monoclonal DNMT3A Antibody (64B1446)

Applications	ChIP, CyTOF-ready, FC, ICC/IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

DNMT3A Rabbit Polyclonal Antibody

TA346818

USD 539.00

5 Days

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications	WB
Reactivities	Mouse, Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE

1 - 2 of 2 results