Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 3 of 3 results

(reset)

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody

TA590756

USD 482.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

MDH2 Rabbit Polyclonal Antibody

TA308153

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926)

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ALDH7A1 Rabbit Polyclonal Antibody

TA344576

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

1 - 3 of 3 results