Antibodies

Jump to Filters
View as table Download
Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody
TA326844

USD 365.00

3 Weeks

Rabbit polyclonal anti-ATP1A1(NaK ATPase) antibody, Loading control

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATP1A1
CACNA1C Goat Polyclonal Antibody
TA305878

USD 520.00

In Stock

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.
UQCRC2 Rabbit Polyclonal Antibody
TA338233

USD 539.00

5 Days

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV