Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 494.00
In Stock
KIT biotinylated mouse monoclonal detection antibody, validated for Luminex assays
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Biotin |
| Matched ELISA Pair | TA600050 |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
USD 494.00
3 Weeks
Goat Polyclonal Antibody against DKK4
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RQHARLRVCQKIEKL, from the C Terminus of the protein sequence according to NP_055235. |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the middle region of human BDNF |
Rabbit Monoclonal CDX2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD34 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
NOTCH1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1 |
Goat Polyclonal KIT/CD117 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1 |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
CD8A rabbit monoclonal antibody, clone SP16, Supernatant
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Families
- Adult stem cells
Citations
- Yes
Filter by
Category
Target Symbol
- CD4 (11)
- CD34 (6)
- CD44 (6)
- CD8A (6)
- CD117 (5)
- CDX2 (5)
- APOLIPOPROTEIN E (4)
- EGFR (4)
- GATA3 (4)
- NOTCH1 (4)
- BDNF (3)
- HES1 (3)
- OCT4 (3)
- BMP4 (2)
- SOX9 (2)
- TAL1 (2)
- WNT2 (2)
- BMP6 (1)
- CD9 (1)
- DKK1 (1)
- DKK4 (1)
- FGF21 (1)
- GLI1 (1)
- GLI2 (1)
- HDAC1 (1)
- HGF (1)
- KLF4 (1)
- LIF (1)
- NEUROD1 (1)
- PAX7 (1)
- SOX2 (1)
- WNT3A (1)
- WNT5A (1)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Hematopoietic cell lineage (35)
- Cell adhesion molecules (CAMs) (23)
- Pathways in cancer (20)
- Antigen processing and presentation (17)
- Primary immunodeficiency (17)
- T cell receptor signaling pathway (17)
- Cytokine-cytokine receptor interaction (11)
- Endocytosis (9)
- Hedgehog signaling pathway (9)
- Melanogenesis (9)
- Basal cell carcinoma (8)
- Dorso-ventral axis formation (8)
- MAPK signaling pathway (8)
- Notch signaling pathway (8)
- ECM-receptor interaction (6)
- Melanoma (6)
- Wnt signaling pathway (6)
- Acute myeloid leukemia (5)
- Focal adhesion (5)
- Regulation of actin cytoskeleton (5)
- Adherens junction (4)
- Alzheimer's disease (4)
- Bladder cancer (4)
- Calcium signaling pathway (4)
- Colorectal cancer (4)
- Endometrial cancer (4)
- Epithelial cell signaling in Helicobacter pylori infection (4)
- ErbB signaling pathway (4)
- Gap junction (4)
- Glioma (4)
- GnRH signaling pathway (4)
- Huntington's disease (4)
- Maturity onset diabetes of the young (4)
- Non-small cell lung cancer (4)
- Pancreatic cancer (4)
- Prion diseases (4)
- Prostate cancer (4)
- Neurotrophin signaling pathway (3)
- TGF-beta signaling pathway (3)
- Cell cycle (1)
- Chronic myeloid leukemia (1)
- Jak-STAT signaling pathway (1)
- Renal cell carcinoma (1)