Germany
Japan
United Kingdom
China
USD 447.00
In Stock
Antibodies
View as table Download
USD 447.00
In Stock
SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 447.00
In Stock
USD 200.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Antibody against SAT1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit polyclonal anti-OAT antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human OAT. |
Rabbit Polyclonal Anti-GLS Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT |
Goat Polyclonal Antibody against P4HA1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DFARKDEPDAFKE, from the internal region of the protein sequence according to NP_000908.2; NP_001017962.1. |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Conjugates
- Unconjugated
Pathways
- Arginine and proline metabolism
Citations
- Yes