Anti-SV2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A |
Anti-SV2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A |
Goat Polyclonal Antibody against SV2A
Applications | WB |
Reactivities | Rat (Expected from sequence similarity: Human, Mouse, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TVELYPSDKRTTA, from the internal region of the protein sequence according to NP_055664.2. |
Rabbit Polyclonal Anti-SV2A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT |