Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Anti-IL18 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal IRF7 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7. |
Rabbit Polyclonal RIG-1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIG-1 antibody was raised against human GST-tagged RIG-1 protein. |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
Modifications | Phospho-specific |
Rabbit Polyclonal TREX1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TREX1 antibody was raised against a 15 amino acid peptide near the center of human TREX1. |
Goat Anti-IL18 Antibody
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
Anti-DDX58 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 909-925 amino acids of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 |
Rabbit polyclonal anti-AIM2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIM2. |
Rabbit Polyclonal Anti-IL18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS |
Rabbit polyclonal IL-1 beta antibody
Applications | WB |
Reactivities | Human, Primate, Dog |
Conjugation | Unconjugated |
Immunogen | This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1). |