Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Chicken, Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal Anti-MC1R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MC1R antibody is: synthetic peptide directed towards the C-terminal region of MC1R. Synthetic peptide located within the following region: CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS |
Goat Polyclonal KIT/CD117 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1 |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Active filters
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Melanogenesis
Citations
- Yes