NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD68 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD68 mouse monoclonal antibody,clone UMAB150
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD63 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
Rabbit polyclonal SLC11A2 Antibody (Center)
Applications | IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD68 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NEU1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD68 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
SLC11A2 / DMT1 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Gibbon (Predicted: Monkey, Bovine, Pig) |
Conjugation | Unconjugated |
Immunogen | SLC11A2 / DMT1 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Pig (93%); Dog, Rabbit (87%); Marmoset, Panda (80%). |
CD107a / LAMP1 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LAMP1 / CD107a antibody was raised against synthetic peptide from human LAMP1. |