Antibodies

Jump to Filters
View as table Download
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334652

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
TA503037

USD 447.00

In Stock

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated