Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
IL10 (Center) Rabbit Polyclonal Antibody
AP52181PU-N

USD 580.00

2 Weeks

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.
C2 Rabbit Polyclonal Antibody
TA346155

USD 539.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS