Rabbit Polyclonal UCP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UCP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human UCP1 (GenBank accession. |
Rabbit Polyclonal UCP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UCP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human UCP1 (GenBank accession. |
Rabbit Polyclonal Anti-PPARGC1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
Modifications | Phospho-specific |
USD 590.00
2 Weeks
Rabbit polyclonal SOD (Cu/Zn) Antibody
Applications | IF, WB |
Reactivities | Human, Rat, Mouse, Bovine, Monkey, Dog, Hamster, Rabbit, Pig, Sheep, Xenopus, Coral |
Conjugation | Unconjugated |
Immunogen | Human Cu/Zn SOD |
Rabbit Polyclonal Cleaved-caspase 3 antibody
Applications | WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Anti-DLG4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 93-106 amino acids of Human discs, large homolog 4 (Drosophila) |
Goat Polyclonal Antibody against SOD1
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1. |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
Conjugation | Unconjugated |
Immunogen | Recombinant human Caspase-3 protein (full length) |
BDNF rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide mapping at the middle region of human BDNF |
Rabbit Polyclonal Anti-sod2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2 |