Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
| Modifications | Phospho-specific |
USD 590.00
2 Weeks
Rabbit Polyclonal Cleaved-caspase 3 antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Goat Polyclonal Antibody against PPID / CyP-40
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1. |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human Caspase-3 protein (full length) |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the middle region of human BDNF |
Rabbit Polyclonal Anti-COX6C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |
Rabbit Polyclonal Anti-sod2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2 |
Germany
Japan
United Kingdom
China
