TREM2 R47H Rabbit monoclonal antibody, clone OTIR4F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TREM2 R47H Rabbit monoclonal antibody, clone OTIR4F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TREM2 Rabbit monoclonal antibody, clone OTIR3B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TREM2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length human recombinant protein of human TREM2 (NP_061838) produced in Expi 293F. |
TREM2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS |
Rabbit polyclonal Anti-TREM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TREM2 antibody: synthetic peptide directed towards the middle region of human TREM2. Synthetic peptide located within the following region: FPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASA |
Trem2 goat polyclonal antibody, Aff - Purified
Applications | IF, PEP-ELISA |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_112544.1. |
TREM2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length human recombinant protein of human TREM2 (NP_061838) produced in Expi 293F. |
TREM2 mouse monoclonal antibody, clone 2B5, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
TREM2 mouse monoclonal antibody, clone 2B5, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Goat Anti-TREM2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HGQKPGTHPPSELD, from the C Terminus of the protein sequence according to NP_061838.1. |
Rabbit Polyclonal Anti-TREM2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TREM2 |
TREM2 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide (C-HGQKPGTHPPSELD) from C-terminus of Human TREM2 |
TREM2 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1). |
Modifications | Unmodified |
Anti-TREM2 Reference Antibody (Py314)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Trem2 rat monoclonal antibody, clone 6E9, Purified
Applications | ELISA, IP |
Reactivities | Mouse |
Conjugation | Unconjugated |