Antibodies

View as table Download

TREM2 R47H Rabbit monoclonal antibody, clone OTIR4F7

Applications WB
Reactivities Human
Conjugation Unconjugated

TREM2 Rabbit monoclonal antibody, clone OTIR3B2

Applications WB
Reactivities Human
Conjugation Unconjugated

TREM2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length human recombinant protein of human TREM2 (NP_061838) produced in Expi 293F.

TREM2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS

Rabbit polyclonal Anti-TREM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TREM2 antibody: synthetic peptide directed towards the middle region of human TREM2. Synthetic peptide located within the following region: FPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASA

Trem2 goat polyclonal antibody, Aff - Purified

Applications IF, PEP-ELISA
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_112544.1.

TREM2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length human recombinant protein of human TREM2 (NP_061838) produced in Expi 293F.

TREM2 mouse monoclonal antibody, clone 2B5, Purified

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated

TREM2 mouse monoclonal antibody, clone 2B5, Purified

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Goat Anti-TREM2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HGQKPGTHPPSELD, from the C Terminus of the protein sequence according to NP_061838.1.

Rabbit Polyclonal Anti-TREM2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TREM2

TREM2 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide (C-HGQKPGTHPPSELD) from C-terminus of Human TREM2

TREM2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).
Modifications Unmodified

USD 580.00

5 Weeks

Anti-TREM2 Reference Antibody (Py314)

Applications Animal Model, ELISA, FACS, FN, Kinetics
Reactivities Human, Mouse
Conjugation Unconjugated

Trem2 rat monoclonal antibody, clone 6E9, Purified

Applications ELISA, IP
Reactivities Mouse
Conjugation Unconjugated