Anti-TPM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TPM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TPM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-TPM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
TPM1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TPM1 |
TPM1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TPM1 |
TPM1 (Sarcomeric) mouse monoclonal antibody, clone ST-39, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Chicken, Human, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TPM1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
TPM1 (36Da) mouse monoclonal antibody, clone TM-36, Purified
Applications | IF, IHC, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
Tropomyosin-1 alpha phospho S283 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Tropomyosin-1 alpha pS283 affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide surrounding S283 human Tropomyosin-1 alpha pS283. |
TPM1 (36/39kDa) mouse monoclonal antibody, clone TM-33, Purified
Applications | WB |
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |