Antibodies

Jump to Filters
View as table Download
P2rx4 Rabbit Polyclonal Antibody
TA328992

USD 905.00

3 Weeks

Rabbit polyclonal Anti-P2X4 Receptor

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KKYKYVEDYEQGLSGEMNQ, corresponding to amino acid residues 370-388 of rat P2X4 Receptor? . Intracellular, C-terminus.
P2RX4 Goat Polyclonal Antibody
AP31932PU-N

USD 520.00

5 Days

P2RX4 goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_035156.2.
P2RX4 Rabbit Polyclonal Antibody
TA379549

USD 365.00

3 Weeks

P2RX4 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-338 of human P2RX4 (NP_002551.2).
Modifications Unmodified
P2RX4 Goat Polyclonal Antibody
TA303372

USD 520.00

5 Days

Goat Polyclonal Antibody against P2RX4

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-YREKKYKYVEDYEQ, from the C Terminus of the protein sequence according to NP_002551.2.
P2RX4 Rabbit Polyclonal Antibody
TA338779

USD 539.00

5 Days

Rabbit Polyclonal Anti-P2RX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX4 antibody: synthetic peptide directed towards the N terminal of human P2RX4. Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW