NEGR1 mouse monoclonal antibody,clone OTI3G8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NEGR1 mouse monoclonal antibody,clone OTI3G8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NEGR1 mouse monoclonal antibody,clone OTI3G8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
NEGR1 mouse monoclonal antibody,clone OTI3G8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NEGR1 mouse monoclonal antibody,clone OTI3G8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NEGR1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NEGR1 |
NEGR1 mouse monoclonal antibody,clone OTI3G8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-NEGR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NEGR1. |
NEGR1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NEGR1 |
Rabbit Polyclonal antibody to NEGR1 (neuronal growth regulator 1)
Applications | IHC |
Reactivities | Mouse (Predicted: Human) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 82 and 354 of NEGR1 (Uniprot ID#Q7Z3B1) |
Rabbit polyclonal Anti-NEGR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1. Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV |