Antibodies

View as table Download

Rabbit Polyclonal Anti-MAGEE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAGEE1

Rabbit Polyclonal Anti-MAGEC2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAGEC2

MAGEE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAGEE1

Rabbit polyclonal anti-MAGEC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAGEC2.

Rabbit Polyclonal Anti-MAGEC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEC2 antibody: synthetic peptide directed towards the N terminal of human MAGEC2. Synthetic peptide located within the following region: SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF