Antibodies

Jump to Filters
View as table Download
LTBP1 Rabbit Polyclonal Antibody
TA342898

USD 539.00

5 Days

Rabbit Polyclonal Anti-LTBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTBP1 antibody: synthetic peptide directed towards the C terminal of human LTBP1. Synthetic peptide located within the following region: NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK
LTBP1 Rabbit Polyclonal Antibody
TA378162

USD 365.00

3 Weeks

LTBP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1290-1540 of human LTBP1 (NP_996826.2).
Modifications Unmodified