Germany
Japan
United Kingdom
China
CD8B mouse monoclonal antibody, clone 2ST8.5H7, Purified
| Applications | FC, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Antibodies
View as table DownloadCd8b1 rat monoclonal antibody, clone CT-CD8b, Purified
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
CD8B mouse monoclonal antibody, clone EP42, FITC
| Applications | FC |
| Reactivities | Chicken |
| Conjugation | FITC |
CD8B (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-term region of human CD8B1 |
Cd8b1 rat monoclonal antibody, clone CT-CD8b, Biotin
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Biotin |
Cd8b1 rat monoclonal antibody, clone CT-CD8b, Biotin
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Biotin |
Cd8b mouse monoclonal antibody, clone 3.4.1, Biotin
| Applications | FC |
| Reactivities | Rat |
| Conjugation | Biotin |
Cd8b mouse monoclonal antibody, clone 3.4.1, Biotin
| Applications | FC |
| Reactivities | Rat |
| Conjugation | Biotin |
Cd8b mouse monoclonal antibody, clone 3.4.1, FITC
| Applications | FC |
| Reactivities | Rat |
| Conjugation | FITC |
Cd8b mouse monoclonal antibody, clone 3.4.1, PE
| Applications | FC |
| Reactivities | Rat |
| Conjugation | PE |
CD8B mouse monoclonal antibody, clone CC58, PE
| Applications | FC |
| Reactivities | Bovine |
| Conjugation | PE |
Rabbit Polyclonal anti-CD8B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: LCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILK |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
Active filters
Category
- Antibodies
Target Symbol
- CD8B